DIRAS1 antibody (70R-5821)

Rabbit polyclonal DIRAS1 antibody raised against the N terminal of DIRAS1

Synonyms Polyclonal DIRAS1 antibody, Anti-DIRAS1 antibody, Di-Ras1 antibody, Diras Family Gtp-Binding Ras-Like 1 antibody, RIG antibody, GBTS1 antibody, FLJ42681 antibody
Specificity DIRAS1 antibody was raised against the N terminal of DIRAS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD
Assay Information DIRAS1 Blocking Peptide, catalog no. 33R-7059, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody


Western Blot analysis using DIRAS1 antibody (70R-5821)

DIRAS1 antibody (70R-5821) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DIRAS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DIRAS1 antibody (70R-5821) | DIRAS1 antibody (70R-5821) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors