DIS3 antibody (70R-4678)

Rabbit polyclonal DIS3 antibody

Synonyms Polyclonal DIS3 antibody, Anti-DIS3 antibody, bA555G22.1 antibody, FLJ10484 antibody, KIAA1008 antibody, DIS-3, Dis3 Mitotic Control Homolog antibody, DIS3, MGC33035 antibody, DIS-3 antibody, RP11-342J4.3 antibody, DKFZp667L1817 antibody, DIS 3 antibody, DIS 3, dis3p antibody, RRP44 antibody
Cross Reactivity Human
Applications WB
Immunogen DIS3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML
Assay Information DIS3 Blocking Peptide, catalog no. 33R-2010, is also available for use as a blocking control in assays to test for specificity of this DIS3 antibody

Images

Western Blot analysis using DIS3 antibody (70R-4678)

DIS3 antibody (70R-4678) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 109 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DIS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DIS3, belonging to the ribonuclease II (RNB) family, has a 3'-5' exonuclease activity. It is a catalytic component of the exosome 3'->5' exoribonuclease complex required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DIS3 antibody (70R-4678) | DIS3 antibody (70R-4678) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors