DKFZP761C169 antibody (70R-2280)

Rabbit polyclonal DKFZP761C169 antibody raised against the N terminal Of Dkfzp761C169

Synonyms Polyclonal DKFZP761C169 antibody, Anti-DKFZP761C169 antibody
Specificity DKFZP761C169 antibody was raised against the N terminal Of Dkfzp761C169
Cross Reactivity Human
Applications IHC, WB
Immunogen DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
Assay Information DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody


Western Blot analysis using DKFZP761C169 antibody (70R-2280)

DKFZP761C169 antibody (70R-2280) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKFZP761C169 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DKFZP761C169 antibody (70R-2280) | DKFZP761C169 antibody (70R-2280) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors