DKKL1 antibody (70R-7515)

Rabbit polyclonal DKKL1 antibody

Synonyms Polyclonal DKKL1 antibody, Anti-DKKL1 antibody, SGY1 antibody, Soggy antibody, SGY antibody, Dickkopf-Like 1 antibody, SGY-1 antibody
Cross Reactivity Human
Applications WB
Immunogen DKKL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH
Assay Information DKKL1 Blocking Peptide, catalog no. 33R-1858, is also available for use as a blocking control in assays to test for specificity of this DKKL1 antibody

Images

Western Blot analysis using DKKL1 antibody (70R-7515)

DKKL1 antibody (70R-7515) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DKKL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DKKL1 antibody (70R-7515) | DKKL1 antibody (70R-7515) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors