DLG2 antibody (70R-6620)

Rabbit polyclonal DLG2 antibody

Synonyms Polyclonal DLG2 antibody, Anti-DLG2 antibody, MGC131811 antibody, DKFZp781D1854 antibody, DKFZp781E0954 antibody, FLJ37266 antibody, Discs Large Homolog 2 Chapsyn-110 antibody, PSD-93 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS
Assay Information DLG2 Blocking Peptide, catalog no. 33R-5991, is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody

Images

Western Blot analysis using DLG2 antibody (70R-6620)

DLG2 antibody (70R-6620) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLG2 antibody (70R-6620) | DLG2 antibody (70R-6620) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors