DLG3 antibody (70R-6604)

Rabbit polyclonal DLG3 antibody

Synonyms Polyclonal DLG3 antibody, Anti-DLG3 antibody, MRX90 antibody, Neuroendocrine-Dlg Drosophila antibody, NE-Dlg antibody, SAP102 antibody, KIAA1232 antibody, NEDLG antibody, MRX antibody, Discs Large Homolog 3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG
Assay Information DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody


Western Blot analysis using DLG3 antibody (70R-6604)

DLG3 antibody (70R-6604) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLG3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DLG3 antibody (70R-6604) | DLG3 antibody (70R-6604) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors