DLK1 antibody (70R-7281)

Rabbit polyclonal DLK1 antibody

Synonyms Polyclonal DLK1 antibody, Anti-DLK1 antibody, Pref-1 antibody, FA1 antibody, ZOG antibody, PREF1 antibody, Delta-Like 1 Homolog antibody, DLK antibody, pG2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
Assay Information DLK1 Blocking Peptide, catalog no. 33R-8692, is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Images

Western Blot analysis using DLK1 antibody (70R-7281)

DLK1 antibody (70R-7281) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLK1 may have a role in neuroendocrine differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLK1 antibody (70R-7281) | DLK1 antibody (70R-7281) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors