DLL1 antibody (70R-6123)

Rabbit polyclonal DLL1 antibody

Synonyms Polyclonal DLL1 antibody, Anti-DLL1 antibody, Delta antibody, DELTA1 antibody, Delta-Like 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Assay Information DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody

Images

Immunohistochemical staining using DLL1 antibody (70R-6123)

DLL1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DLL1 antibody (70R-6123) | DLL1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using DLL1 antibody (70R-6123) | DLL1 antibody (70R-6123) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using DLL1 antibody (70R-6123) | DLL1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors