DLL3 antibody (70R-7121)

Rabbit polyclonal DLL3 antibody

Synonyms Polyclonal DLL3 antibody, Anti-DLL3 antibody, Delta-Like 3 antibody, SCDO1 antibody
Cross Reactivity Human
Applications WB
Immunogen DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
Assay Information DLL3 Blocking Peptide, catalog no. 33R-6609, is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody

Images

Western Blot analysis using DLL3 antibody (70R-7121)

DLL3 antibody (70R-7121) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLL3 antibody (70R-7121) | DLL3 antibody (70R-7121) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors