DLL4 antibody (70R-6608)

Rabbit polyclonal DLL4 antibody

Synonyms Polyclonal DLL4 antibody, Anti-DLL4 antibody, MGC126344 antibody, hdelta2 antibody, Delta-Like 4 antibody
Cross Reactivity Human
Applications WB
Immunogen DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF
Assay Information DLL4 Blocking Peptide, catalog no. 33R-7573, is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody

Images

Western Blot analysis using DLL4 antibody (70R-6608)

Western Blot showing DLL4 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DLL4 antibody (70R-6608) | Western Blot showing DLL4 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors