DMBT1 antibody (70R-3916)

Rabbit polyclonal DMBT1 antibody raised against the N terminal of DMBT1

Synonyms Polyclonal DMBT1 antibody, Anti-DMBT1 antibody, Deleted In Malignant Brain Tumors 1 antibody, DMBT-1, GP340 antibody, MGC164738 antibody, DMBT-1 antibody, DMBT 1, muclin antibody, DMBT 1 antibody, DMBT1
Specificity DMBT1 antibody was raised against the N terminal of DMBT1
Cross Reactivity Human
Applications WB
Immunogen DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Assay Information DMBT1 Blocking Peptide, catalog no. 33R-8945, is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody


Western Blot analysis using DMBT1 antibody (70R-3916)

DMBT1 antibody (70R-3916) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 258 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DMBT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DMBT1 antibody (70R-3916) | DMBT1 antibody (70R-3916) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors