DNAJA2 antibody (70R-4498)

Rabbit polyclonal DNAJA2 antibody

Synonyms Polyclonal DNAJA2 antibody, Anti-DNAJA2 antibody, Dnaj antibody, Hsp40 Homolog Subfamily A 2 antibody, DJA2 antibody, DNAJ antibody, DNJ3 antibody, CPR3 antibody, HIRIP4 antibody, PRO3015 antibody, RDJ2 antibody
Cross Reactivity Human
Applications WB
Immunogen DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGM
Assay Information DNAJA2 Blocking Peptide, catalog no. 33R-10127, is also available for use as a blocking control in assays to test for specificity of this DNAJA2 antibody


Western Blot analysis using DNAJA2 antibody (70R-4498)

DNAJA2 antibody (70R-4498) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNAJA2 antibody (70R-4498) | DNAJA2 antibody (70R-4498) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors