DNAJB1 antibody (70R-3606)

Rabbit polyclonal DNAJB1 antibody

Synonyms Polyclonal DNAJB1 antibody, Anti-DNAJB1 antibody, Hsp40 antibody, Dnaj antibody, Hdj1 antibody, HSPF1 antibody, Sis1 antibody, Hsp40 Homolog Subfamily B 1 antibody
Cross Reactivity Human
Applications WB
Immunogen DNAJB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
Assay Information DNAJB1 Blocking Peptide, catalog no. 33R-3564, is also available for use as a blocking control in assays to test for specificity of this DNAJB1 antibody


Western Blot analysis using DNAJB1 antibody (70R-3606)

DNAJB1 antibody (70R-3606) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNAJB1 antibody (70R-3606) | DNAJB1 antibody (70R-3606) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors