DNAJB11 antibody (70R-7353)

Rabbit polyclonal DNAJB11 antibody

Synonyms Polyclonal DNAJB11 antibody, Anti-DNAJB11 antibody, ABBP-2 antibody, ERdj3 antibody, PRO1080 antibody, Dnaj antibody, ABBP2 antibody, hDj9 antibody, UNQ537 antibody, ERj3 antibody, HEDJ antibody, Hsp40 Homolog Subfamily B 11 antibody, EDJ antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
Assay Information DNAJB11 Blocking Peptide, catalog no. 33R-2868, is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Images

Western Blot analysis using DNAJB11 antibody (70R-7353)

DNAJB11 antibody (70R-7353) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a C-terminal cysteine-rich region.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNAJB11 antibody (70R-7353) | DNAJB11 antibody (70R-7353) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors