DNAJB12 antibody (70R-6342)

Rabbit polyclonal DNAJB12 antibody

Synonyms Polyclonal DNAJB12 antibody, Anti-DNAJB12 antibody, DKFZp586B2023 antibody, Dnaj antibody, DJ10 antibody, Hsp40 Homolog Subfamily B 12 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS
Assay Information DNAJB12 Blocking Peptide, catalog no. 33R-4048, is also available for use as a blocking control in assays to test for specificity of this DNAJB12 antibody

Images

Western blot analysis using DNAJB12 antibody (70R-6342)

Recommended DNAJB12 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJB12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using DNAJB12 antibody (70R-6342) | Recommended DNAJB12 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors