DNAJC1 antibody (70R-7434)

Rabbit polyclonal DNAJC1 antibody

Synonyms Polyclonal DNAJC1 antibody, Anti-DNAJC1 antibody, HTJ1 antibody, ERdj1 antibody, MGC131954 antibody, Dnaj antibody, Hsp40 Homolog Subfamily C 1 antibody, DNAJL1 antibody
Cross Reactivity Human
Applications WB
Immunogen DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT
Assay Information DNAJC1 Blocking Peptide, catalog no. 33R-7786, is also available for use as a blocking control in assays to test for specificity of this DNAJC1 antibody

Images

Western Blot analysis using DNAJC1 antibody (70R-7434)

DNAJC1 antibody (70R-7434) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNAJC1 antibody (70R-7434) | DNAJC1 antibody (70R-7434) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors