DNAJC10 antibody (70R-6576)

Rabbit polyclonal DNAJC10 antibody

Synonyms Polyclonal DNAJC10 antibody, Anti-DNAJC10 antibody, Dnaj antibody, Hsp40 Homolog Subfamily C 10 antibody, MGC104194 antibody, ERdj5 antibody, DKFZp434J1813 antibody, JPDI antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY
Assay Information DNAJC10 Blocking Peptide, catalog no. 33R-1941, is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody

Images

Western Blot analysis using DNAJC10 antibody (70R-6576)

DNAJC10 antibody (70R-6576) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJC10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNAJC10 antibody (70R-6576) | DNAJC10 antibody (70R-6576) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors