DNAJC12 antibody (70R-3982)

Rabbit polyclonal DNAJC12 antibody

Synonyms Polyclonal DNAJC12 antibody, Anti-DNAJC12 antibody, JDP1 antibody, Dnaj antibody, Hsp40 Homolog Subfamily C 12 antibody
Cross Reactivity Human
Applications WB
Immunogen DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE
Assay Information DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody

Images

Western Blot analysis using DNAJC12 antibody (70R-3982)

DNAJC12 antibody (70R-3982) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJC12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNAJC12 antibody (70R-3982) | DNAJC12 antibody (70R-3982) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors