DNAJC25 antibody (70R-6333)

Rabbit polyclonal DNAJC25 antibody

Synonyms Polyclonal DNAJC25 antibody, Anti-DNAJC25 antibody, Hsp40 Homolog Subfamily C 25 antibody, Dnaj antibody
Cross Reactivity Human
Applications WB
Immunogen DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC
Assay Information DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody

Images

Western Blot analysis using DNAJC25 antibody (70R-6333)

DNAJC25 antibody (70R-6333) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJC25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNAJC25 may be involved in heat shock protein binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNAJC25 antibody (70R-6333) | DNAJC25 antibody (70R-6333) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors