DNAL1 Blocking Peptide (33R-10418)

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAL1 antibody, catalog no. 70R-10420

Synonyms DNAL1 control peptide, DNAL1 antibody Blocking Peptide, Anti-DNAL1 Blocking Peptide, dynein, axonemal, light chain 1 Blocking Peptide, C14orf168 Blocking Peptide, MGC12435 Blocking Peptide, DNAL1, DNAL-1, DNAL 1, DNAL-1 Blocking Peptide, DNAL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLS
Molecular Weight 17 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors