DNALI1 antibody (70R-3315)

Rabbit polyclonal DNALI1 antibody raised against the N terminal of DNALI1

Synonyms Polyclonal DNALI1 antibody, Anti-DNALI1 antibody, P28 antibody, hp28 antibody, Dynein Axonemal Light Intermediate Chain 1 antibody, dJ423B22.5 antibody
Specificity DNALI1 antibody was raised against the N terminal of DNALI1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
Assay Information DNALI1 Blocking Peptide, catalog no. 33R-6612, is also available for use as a blocking control in assays to test for specificity of this DNALI1 antibody


Western Blot analysis using DNALI1 antibody (70R-3315)

DNALI1 antibody (70R-3315) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNALI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNALI1 antibody (70R-3315) | DNALI1 antibody (70R-3315) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors