DNASE1 antibody (70R-6299)

Rabbit polyclonal DNASE1 antibody raised against the N terminal of DNASE1

Synonyms Polyclonal DNASE1 antibody, Anti-DNASE1 antibody, DNL1 antibody, FLJ38093 antibody, DRNI antibody, FLJ44902 antibody, Deoxyribonuclease I antibody, DKFZp686H0155 antibody
Specificity DNASE1 antibody was raised against the N terminal of DNASE1
Cross Reactivity Human
Applications WB
Immunogen DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Assay Information DNASE1 Blocking Peptide, catalog no. 33R-3371, is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Images

Western Blot analysis using DNASE1 antibody (70R-6299)

DNASE1 antibody (70R-6299) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNASE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNASE1 antibody (70R-6299) | DNASE1 antibody (70R-6299) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors