DNASE2B antibody (70R-7163)

Rabbit polyclonal DNASE2B antibody raised against the middle region of DNASE2B

Synonyms Polyclonal DNASE2B antibody, Anti-DNASE2B antibody, Deoxyribonuclease Ii Beta antibody, DLAD antibody
Specificity DNASE2B antibody was raised against the middle region of DNASE2B
Cross Reactivity Human
Applications WB
Immunogen DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Assay Information DNASE2B Blocking Peptide, catalog no. 33R-4011, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody


Western Blot analysis using DNASE2B antibody (70R-7163)

DNASE2B antibody (70R-7163) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNASE2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNASE2B antibody (70R-7163) | DNASE2B antibody (70R-7163) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors