DNTT antibody (70R-5666)

Rabbit polyclonal DNTT antibody raised against the N terminal of DNTT

Synonyms Polyclonal DNTT antibody, Anti-DNTT antibody, Deoxynucleotidyltransferase Terminal antibody, TDT antibody
Specificity DNTT antibody was raised against the N terminal of DNTT
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DNTT antibody was raised using the N terminal of DNTT corresponding to a region with amino acids FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG
Assay Information DNTT Blocking Peptide, catalog no. 33R-3028, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody

Images

Western Blot analysis using DNTT antibody (70R-5666)

DNTT antibody (70R-5666) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNTT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNTT is a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, DNTT is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor geneegments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DNTT antibody (70R-5666) | DNTT antibody (70R-5666) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors