DNTT antibody (70R-5671)

Rabbit polyclonal DNTT antibody raised against the middle region of DNTT

Synonyms Polyclonal DNTT antibody, Anti-DNTT antibody, Deoxynucleotidyltransferase Terminal antibody, TDT antibody
Specificity DNTT antibody was raised against the middle region of DNTT
Cross Reactivity Human
Applications WB
Immunogen DNTT antibody was raised using the middle region of DNTT corresponding to a region with amino acids LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
Assay Information DNTT Blocking Peptide, catalog no. 33R-5388, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody


Western Blot analysis using DNTT antibody (70R-5671)

DNTT antibody (70R-5671) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNTT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor geneegments during the maturation of B- and T-cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DNTT antibody (70R-5671) | DNTT antibody (70R-5671) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors