DOCK2 antibody (70R-5803)

Rabbit polyclonal DOCK2 antibody raised against the middle region of DOCK2

Synonyms Polyclonal DOCK2 antibody, Anti-DOCK2 antibody, Dedicator Of Cytokinesis 2 antibody, KIAA0209 antibody, FLJ46592 antibody
Specificity DOCK2 antibody was raised against the middle region of DOCK2
Cross Reactivity Human, Mouse
Applications WB
Immunogen DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
Assay Information DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody


Western Blot analysis using DOCK2 antibody (70R-5803)

Western Blot showing DOCK2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 212 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DOCK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DOCK2 antibody (70R-5803) | Western Blot showing DOCK2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors