DOK5 antibody (70R-3341)

Rabbit polyclonal DOK5 antibody raised against the N terminal of DOK5

Synonyms Polyclonal DOK5 antibody, Anti-DOK5 antibody, C20orf180 antibody, Docking Protein 5 antibody, MGC16926 antibody
Specificity DOK5 antibody was raised against the N terminal of DOK5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD
Assay Information DOK5 Blocking Peptide, catalog no. 33R-3474, is also available for use as a blocking control in assays to test for specificity of this DOK5 antibody

Images

Western Blot analysis using DOK5 antibody (70R-3341)

DOK5 antibody (70R-3341) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DOK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. It interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DOK5 antibody (70R-3341) | DOK5 antibody (70R-3341) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors