DOK6 antibody (70R-4595)

Rabbit polyclonal DOK6 antibody raised against the middle region of DOK6

Synonyms Polyclonal DOK6 antibody, Anti-DOK6 antibody, Docking Protein 6 antibody, HsT3226 antibody, MGC20785 antibody, DOK5L antibody
Specificity DOK6 antibody was raised against the middle region of DOK6
Cross Reactivity Human
Applications WB
Immunogen DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
Assay Information DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody

Images

Western Blot analysis using DOK6 antibody (70R-4595)

DOK6 antibody (70R-4595) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DOK6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DOK6 antibody (70R-4595) | DOK6 antibody (70R-4595) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors