DOLPP1 antibody (70R-6895)

Rabbit polyclonal DOLPP1 antibody raised against the N terminal of DOLPP1

Synonyms Polyclonal DOLPP1 antibody, Anti-DOLPP1 antibody, LSFR2 antibody, Dolichyl Pyrophosphate Phosphatase 1 antibody
Specificity DOLPP1 antibody was raised against the N terminal of DOLPP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI
Assay Information DOLPP1 Blocking Peptide, catalog no. 33R-1013, is also available for use as a blocking control in assays to test for specificity of this DOLPP1 antibody

Images

Western Blot analysis using DOLPP1 antibody (70R-6895)

DOLPP1 antibody (70R-6895) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DOLPP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DOLPP1 antibody (70R-6895) | DOLPP1 antibody (70R-6895) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors