DONSON antibody (70R-1997)

Rabbit polyclonal DONSON antibody raised against the middle region of DONSON

Synonyms Polyclonal DONSON antibody, Anti-DONSON antibody, DKFZP434M035 antibody, Downstream Neighbor Of Son antibody, B17 antibody, C21orf60 antibody
Specificity DONSON antibody was raised against the middle region of DONSON
Cross Reactivity Human,Mouse
Applications WB
Immunogen DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Assay Information DONSON Blocking Peptide, catalog no. 33R-2048, is also available for use as a blocking control in assays to test for specificity of this DONSON antibody


Western Blot analysis using DONSON antibody (70R-1997)

DONSON antibody (70R-1997) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DONSON antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DONSON antibody (70R-1997) | DONSON antibody (70R-1997) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors