DPCR1 antibody (70R-7023)

Rabbit polyclonal DPCR1 antibody raised against the C terminal of DPCR1

Synonyms Polyclonal DPCR1 antibody, Anti-DPCR1 antibody, DPCR 1, MGC126710 antibody, PBLT antibody, DPCR-1, Diffuse Panbronchiolitis Critical Region 1 antibody, DPCR-1 antibody, bCX105N19.6 antibody, DPCR1, DPCR 1 antibody, MGC126712 antibody
Specificity DPCR1 antibody was raised against the C terminal of DPCR1
Cross Reactivity Human
Applications WB
Immunogen DPCR1 antibody was raised using the C terminal of DPCR1 corresponding to a region with amino acids SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
Assay Information DPCR1 Blocking Peptide, catalog no. 33R-8512, is also available for use as a blocking control in assays to test for specificity of this DPCR1 antibody

Images

Western Blot analysis using DPCR1 antibody (70R-7023)

DPCR1 antibody (70R-7023) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPCR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DPCR1 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPCR1 antibody (70R-7023) | DPCR1 antibody (70R-7023) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors