DPH1 antibody (70R-4122)

Rabbit polyclonal DPH1 antibody

Synonyms Polyclonal DPH1 antibody, Anti-DPH1 antibody, Dph1 Homolog antibody, DPH2L1 antibody, DPH2L antibody, OVCA1 antibody, FLJ33211 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV
Assay Information DPH1 Blocking Peptide, catalog no. 33R-8068, is also available for use as a blocking control in assays to test for specificity of this DPH1 antibody


Western Blot analysis using DPH1 antibody (70R-4122)

DPH1 antibody (70R-4122) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DPH1 antibody (70R-4122) | DPH1 antibody (70R-4122) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors