DPP10 antibody (70R-6500)

Rabbit polyclonal DPP10 antibody raised against the middle region of DPP10

Synonyms Polyclonal DPP10 antibody, Anti-DPP10 antibody, DPP 10 antibody, Dipeptidyl-Peptidase 10 antibody, DPP 10, DPP10, DPPY antibody, DPP -10 antibody, DPRP3 antibody, DPL2 antibody, DPP -10
Specificity DPP10 antibody was raised against the middle region of DPP10
Cross Reactivity Human
Applications WB
Immunogen DPP10 antibody was raised using the middle region of DPP10 corresponding to a region with amino acids VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE
Assay Information DPP10 Blocking Peptide, catalog no. 33R-9716, is also available for use as a blocking control in assays to test for specificity of this DPP10 antibody

Images

Western Blot analysis using DPP10 antibody (70R-6500)

DPP10 antibody (70R-6500) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPP10 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Mutations in this gene have been associated with asthma.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPP10 antibody (70R-6500) | DPP10 antibody (70R-6500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors