DPP6 antibody (70R-6328)

Rabbit polyclonal DPP6 antibody raised against the middle region of DPP6

Synonyms Polyclonal DPP6 antibody, Anti-DPP6 antibody, DPPX antibody, DPP-6 antibody, DPP-6, DPP6, MGC46605 antibody, Dipeptidyl-Peptidase 6 antibody, DPP 6 antibody, DPP 6
Specificity DPP6 antibody was raised against the middle region of DPP6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ
Assay Information DPP6 Blocking Peptide, catalog no. 33R-2964, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody

Images

Western Blot analysis using DPP6 antibody (70R-6328)

DPP6 antibody (70R-6328) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPP6 antibody (70R-6328) | DPP6 antibody (70R-6328) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors