DPPA2 antibody (70R-2389)

Rabbit polyclonal DPPA2 antibody raised against the N terminal of DPPA2

Synonyms Polyclonal DPPA2 antibody, Anti-DPPA2 antibody, PESCRG1 antibody, Developmental Pluripotency Associated 2 antibody
Specificity DPPA2 antibody was raised against the N terminal of DPPA2
Cross Reactivity Human
Applications WB
Immunogen DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL
Assay Information DPPA2 Blocking Peptide, catalog no. 33R-6792, is also available for use as a blocking control in assays to test for specificity of this DPPA2 antibody

Images

Western Blot analysis using DPPA2 antibody (70R-2389)

DPPA2 antibody (70R-2389) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPPA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPPA2 antibody (70R-2389) | DPPA2 antibody (70R-2389) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors