DPPA5 antibody (70R-2041)

Rabbit polyclonal DPPA5 antibody raised against the N terminal of DPPA5

Synonyms Polyclonal DPPA5 antibody, Anti-DPPA5 antibody, Esg1 antibody, Developmental Pluripotency Associated 5 antibody
Specificity DPPA5 antibody was raised against the N terminal of DPPA5
Cross Reactivity Human
Applications WB
Immunogen DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
Assay Information DPPA5 Blocking Peptide, catalog no. 33R-6080, is also available for use as a blocking control in assays to test for specificity of this DPPA5 antibody


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPPA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors