DPY19L2 antibody (70R-7084)

Rabbit polyclonal DPY19L2 antibody

Synonyms Polyclonal DPY19L2 antibody, Anti-DPY19L2 antibody, FLJ36166 antibody, DPY 19, DPY-19, FLJ32949 antibody, DPY 19 antibody, DPY-19 antibody, DPY19, Dpy-19-Like 2 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen DPY19L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH
Assay Information DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody

Images

Western Blot analysis using DPY19L2 antibody (70R-7084)

DPY19L2 antibody (70R-7084) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPY19L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPY19L2 antibody (70R-7084) | DPY19L2 antibody (70R-7084) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors