DPY19L4 antibody (70R-7039)

Rabbit polyclonal DPY19L4 antibody

Synonyms Polyclonal DPY19L4 antibody, Anti-DPY19L4 antibody, DPY-19 antibody, DPY 19, Dpy-19-Like 4 antibody, DPY-19, DPY 19 antibody, MGC131885 antibody, DPY19
Cross Reactivity Human
Applications WB
Immunogen DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR
Assay Information DPY19L4 Blocking Peptide, catalog no. 33R-1439, is also available for use as a blocking control in assays to test for specificity of this DPY19L4 antibody

Images

Western Blot analysis using DPY19L4 antibody (70R-7039)

DPY19L4 antibody (70R-7039) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPY19L4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of DPY19 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPY19L4 antibody (70R-7039) | DPY19L4 antibody (70R-7039) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors