DPYSL2 antibody (70R-5234)

Rabbit polyclonal DPYSL2 antibody raised against the middle region of DPYSL2

Synonyms Polyclonal DPYSL2 antibody, Anti-DPYSL2 antibody, DRP-2 antibody, DRP2 antibody, DHPRP2 antibody, Dihydropyrimidinase-Like 2 antibody, CRMP2 antibody
Specificity DPYSL2 antibody was raised against the middle region of DPYSL2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR
Assay Information DPYSL2 Blocking Peptide, catalog no. 33R-6719, is also available for use as a blocking control in assays to test for specificity of this DPYSL2 antibody

Images

Western Blot analysis using DPYSL2 antibody (70R-5234)

DPYSL2 antibody (70R-5234) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPYSL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. The protein plays a role in axon guidance, neuronal growth cone collapse and cell migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DPYSL2 antibody (70R-5234) | DPYSL2 antibody (70R-5234) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors