DPYSL3 antibody (70R-5235)

Rabbit polyclonal DPYSL3 antibody raised against the middle region of DPYSL3

Synonyms Polyclonal DPYSL3 antibody, Anti-DPYSL3 antibody, DRP-3 antibody, Dihydropyrimidinase-Like 3 antibody, DRP3 antibody, ULIP antibody, CRMP-4 antibody, CRMP4 antibody
Specificity DPYSL3 antibody was raised against the middle region of DPYSL3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DPYSL3 antibody was raised using the middle region of DPYSL3 corresponding to a region with amino acids VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA
Assay Information DPYSL3 Blocking Peptide, catalog no. 33R-9522, is also available for use as a blocking control in assays to test for specificity of this DPYSL3 antibody


Western Blot analysis using DPYSL3 antibody (70R-5235)

DPYSL3 antibody (70R-5235) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPYSL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DPYSL3 is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. DPYSL3 plays a role in axon guidance, neuronal growth cone collapse and cell migration.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DPYSL3 antibody (70R-5235) | DPYSL3 antibody (70R-5235) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors