DULLARD antibody (70R-6260)

Rabbit polyclonal DULLARD antibody

Synonyms Polyclonal DULLARD antibody, Anti-DULLARD antibody, Dullard Homolog antibody, HSA011916 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
Assay Information DULLARD Blocking Peptide, catalog no. 33R-3807, is also available for use as a blocking control in assays to test for specificity of this DULLARD antibody


Western Blot analysis using DULLARD antibody (70R-6260)

DULLARD antibody (70R-6260) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DULLARD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DULLARD is a serine/threonine phosphatase which may be required for proper nuclear membrane morphology. DULLARD was involved in LPIN1 dephosphorylation. It may antagonize BMP signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DULLARD antibody (70R-6260) | DULLARD antibody (70R-6260) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors