DUS1L antibody (70R-4014)

Rabbit polyclonal DUS1L antibody

Synonyms Polyclonal DUS1L antibody, Anti-DUS1L antibody, DUSL-1 antibody, DUSL 1 antibody, PP3111 antibody, Dihydrouridine Synthase 1-Like antibody, DUS1L, DUSL 1, DUSL-1, DUS1 antibody
Cross Reactivity Human
Applications WB
Immunogen DUS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF
Assay Information DUS1L Blocking Peptide, catalog no. 33R-2345, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody


Western Blot analysis using DUS1L antibody (70R-4014)

DUS1L antibody (70R-4014) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DUS1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DUS1L antibody (70R-4014) | DUS1L antibody (70R-4014) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors