DUSP10 antibody (70R-5836)

Rabbit polyclonal DUSP10 antibody raised against the N terminal of DUSP10

Synonyms Polyclonal DUSP10 antibody, Anti-DUSP10 antibody, DUSP-10 antibody, DUSP 10 antibody, DUSP10, MKP5 antibody, MKP-5 antibody, Dual Specificity Phosphatase 10 antibody, DUSP-10, DUSP 10
Specificity DUSP10 antibody was raised against the N terminal of DUSP10
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE
Assay Information DUSP10 Blocking Peptide, catalog no. 33R-6340, is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody


Western Blot analysis using DUSP10 antibody (70R-5836)

DUSP10 antibody (70R-5836) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DUSP10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DUSP10 antibody (70R-5836) | DUSP10 antibody (70R-5836) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors