DVL2 antibody (70R-5779)

Rabbit polyclonal DVL2 antibody

Synonyms Polyclonal DVL2 antibody, Anti-DVL2 antibody, Dishevelled Dsh Homolog 2 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen DVL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
Assay Information DVL2 Blocking Peptide, catalog no. 33R-1228, is also available for use as a blocking control in assays to test for specificity of this DVL2 antibody

Images

Immunohistochemical staining using DVL2 antibody (70R-5779)

Paraffin embedded small intestine, muscularis propria tissue, tested with an antibody Dilution of 5 ug/ml.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DVL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DVL2 is a member of the dishevelled (dsh) protein family. It is a 90 kDa protein that undergoes posttranslational phosphorylation to form a 95 kDa cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using DVL2 antibody (70R-5779) | Paraffin embedded small intestine, muscularis propria tissue, tested with an antibody Dilution of 5 ug/ml.
  • Western blot analysis using DVL2 antibody (70R-5779) | Recommended DVL2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors