DYDC1 antibody (70R-4150)

Rabbit polyclonal DYDC1 antibody raised against the middle region of DYDC1

Synonyms Polyclonal DYDC1 antibody, Anti-DYDC1 antibody, FLJ43920 antibody, Dpy30 Domain Containing 1 antibody, DYDC-1, DYDC 1 antibody, DYDC-1 antibody, DPY30D1 antibody, DYDC1, DYDC 1, bA36D19.5 antibody
Specificity DYDC1 antibody was raised against the middle region of DYDC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen DYDC1 antibody was raised using the middle region of DYDC1 corresponding to a region with amino acids EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD
Assay Information DYDC1 Blocking Peptide, catalog no. 33R-2315, is also available for use as a blocking control in assays to test for specificity of this DYDC1 antibody

Images

Western Blot analysis using DYDC1 antibody (70R-4150)

DYDC1 antibody (70R-4150) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYDC1 plays a crucial role during acrosome biogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DYDC1 antibody (70R-4150) | DYDC1 antibody (70R-4150) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors