Dynactin 2 Blocking Peptide (33R-1100)

A synthetic peptide for use as a blocking control in assays to test for specificity of DCTN2 antibody, catalog no. 70R-5500

Synonyms Dynactin 2 control peptide, Dynactin 2 antibody Blocking Peptide, Anti-Dynactin 2 Blocking Peptide, DCTN50 Blocking Peptide, DYNAMITIN Blocking Peptide, RBP50 Blocking Peptide, P50 Blocking Peptide, DCTN2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCTN2 is a 50 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors