DYNC1I2 antibody (70R-4497)

Rabbit polyclonal DYNC1I2 antibody raised against the N terminal of DYNC1I2

Synonyms Polyclonal DYNC1I2 antibody, Anti-DYNC1I2 antibody, FLJ21089 antibody, MGC104199 antibody, IC2 antibody, FLJ90842 antibody, MGC9324 antibody, MGC111094 antibody, DNCI2 antibody, Dynein Cytoplasmic 1 Intermediate Chain 2 antibody
Specificity DYNC1I2 antibody was raised against the N terminal of DYNC1I2
Cross Reactivity Human
Applications WB
Immunogen DYNC1I2 antibody was raised using the N terminal of DYNC1I2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH
Assay Information DYNC1I2 Blocking Peptide, catalog no. 33R-9431, is also available for use as a blocking control in assays to test for specificity of this DYNC1I2 antibody

Images

Western Blot analysis using DYNC1I2 antibody (70R-4497)

DYNC1I2 antibody (70R-4497) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYNC1I2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DYNC1I2 antibody (70R-4497) | DYNC1I2 antibody (70R-4497) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors