DYSF antibody (70R-6700)

Rabbit polyclonal DYSF antibody

Synonyms Polyclonal DYSF antibody, Anti-DYSF antibody, Dysferlin Limb Girdle Muscular Dystrophy 2B antibody, FER1L1 antibody, FLJ00175 antibody, LGMD2B antibody, FLJ90168 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids IVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFEL
Assay Information DYSF Blocking Peptide, catalog no. 33R-4205, is also available for use as a blocking control in assays to test for specificity of this DYSF antibody


Western Blot analysis using DYSF antibody (70R-6700)

DYSF antibody (70R-6700) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 237 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYSF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYSF belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. In addition, DYSF binds caveolin-3, a skeletal muscle membrane protein which is important in the formation of caveolae. Specific mutations in this gene have been shown to cause autosomal recessive limb girdle muscular dystrophy type 2B (LGMD2B) as well as Miyoshi myopathy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using DYSF antibody (70R-6700) | DYSF antibody (70R-6700) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors