DYSF antibody (70R-6848)

Rabbit polyclonal DYSF antibody

Synonyms Polyclonal DYSF antibody, Anti-DYSF antibody, FLJ00175 antibody, FER1L1 antibody, LGMD2B antibody, FLJ90168 antibody, Dysferlin Limb Girdle Muscular Dystrophy 2B antibody
Cross Reactivity Human
Applications WB
Immunogen DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids DKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNE
Assay Information DYSF Blocking Peptide, catalog no. 33R-2028, is also available for use as a blocking control in assays to test for specificity of this DYSF antibody

Images

Western Blot analysis using DYSF antibody (70R-6848)

DYSF antibody (70R-6848) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 237 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DYSF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DYSF belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using DYSF antibody (70R-6848) | DYSF antibody (70R-6848) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors