EBP antibody (70R-6689)

Rabbit polyclonal EBP antibody

Synonyms Polyclonal EBP antibody, Anti-EBP antibody, Emopamil Binding Protein antibody, CPXD antibody, CPX antibody, CHO2 antibody, CDPX2 antibody, Sterol Isomerase antibody
Cross Reactivity Human
Applications WB
Immunogen EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
Assay Information EBP Blocking Peptide, catalog no. 33R-5513, is also available for use as a blocking control in assays to test for specificity of this EBP antibody

Images

Western Blot analysis using EBP antibody (70R-6689)

EBP antibody (70R-6689) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using EBP antibody (70R-6689) | EBP antibody (70R-6689) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors